PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK26582.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 337aa    MW: 38171.5 Da    PI: 5.1282
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK26582.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEde+l+++++  G g+W++ +++ g+ R++k+c++rw +yl
       KFK26582.1 14 RGRWTAEEDEILINYIQTNGEGSWRSLPKKAGLLRCGKSCRLRWINYL 61
                     8*******************************99************97 PP

2Myb_DNA-binding551.9e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T+eE++ +v+++ +lG++ W++Ia +++ gRt++++k++w+++l
       KFK26582.1  67 RGNITAEEEDTIVKLHSLLGNR-WSLIATHLP-GRTDNEIKNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-22564IPR009057Homeodomain-like
PROSITE profilePS5129416.826961IPR017930Myb domain
SuperFamilySSF466899.54E-2911108IPR009057Homeodomain-like
SMARTSM007173.3E-131363IPR001005SANT/Myb domain
PfamPF002492.1E-151461IPR001005SANT/Myb domain
CDDcd001673.83E-91661No hitNo description
PROSITE profilePS5129426.61362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.4E-2565116IPR009057Homeodomain-like
SMARTSM007171.9E-1666114IPR001005SANT/Myb domain
PfamPF002491.7E-1567112IPR001005SANT/Myb domain
CDDcd001671.84E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051555Biological Processflavonol biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGRAPCCEKI GLKRGRWTAE EDEILINYIQ TNGEGSWRSL PKKAGLLRCG KSCRLRWINY  60
LRRDLKRGNI TAEEEDTIVK LHSLLGNRWS LIATHLPGRT DNEIKNYWNS HLSRKIYAFT  120
SVCRDEHNPI VDDLIQNKFS ASSEAKNKNK AKKKKKGRTS RSTMKKHKQM VTASQCFPQS  180
KEVESEGGQN GHFEGESLGP YEWLDSEIER LMGSFVWEGE EAVAEVNDDK SHQNKVCESG  240
DSSSCCVGLF EEEQRIGHKE ITKVDHDMNV EIEREGSVLS SNSNENGDQD WWGGLCSSSE  300
IGFGIGEDLL DWEFQGSVTC QSDDLWDLSD IGEITLE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00598PBMTransfer from AT5G49330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199744.10.0myb domain protein 111
TrEMBLA0A087G9N00.0A0A087G9N0_ARAAL; Uncharacterized protein
STRINGAT5G49330.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.10.0myb domain protein 111